PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_016153-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 195aa    MW: 22457.3 Da    PI: 8.8073
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_016153-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85.2e-202175357
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                     k++++++eq++ Le  F  ++++  e++ +LA++lgL+ rqV vWFqNrRa++k+
  AHYPO_016153-RA 21 KKRKLSEEQVNMLEMNFGCEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKN 75
                     56699************************************************95 PP

2HD-ZIP_I/II121.54.1e-3921112293
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      kkr+ls+eqv++LE++F  e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y++L++++++l+ e++rLe+ev +L+++l++
  AHYPO_016153-RA  21 KKRKLSEEQVNMLEMNFGCEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKKLEQEYSKLRDEHENLVVEKCRLETEVLSLKDKLND 112
                      9**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.9081676IPR001356Homeobox domain
SMARTSM003892.1E-181980IPR001356Homeobox domain
SuperFamilySSF466891.84E-182086IPR009057Homeodomain-like
PfamPF000462.3E-172175IPR001356Homeobox domain
CDDcd000861.31E-152177No hitNo description
Gene3DG3DSA:1.10.10.602.0E-202383IPR009057Homeodomain-like
PRINTSPR000311.2E-54756IPR000047Helix-turn-helix motif
PROSITE patternPS0002705174IPR017970Homeobox, conserved site
PRINTSPR000311.2E-55672IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
DEPKRRRRRK NKKGESNSAA KKRKLSEEQV NMLEMNFGCE HKLESERKDR LASELGLDPR  60
QVAVWFQNRR ARWKNKKLEQ EYSKLRDEHE NLVVEKCRLE TEVLSLKDKL NDAKKEIQKL  120
VNERSSASAS ASASVISSST TDNISSNSPS DCSLTMDHPI LAQQQFGLGM GGYWLDTMFY  180
ALPDTSVDWV VDLYM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
138KRRRRR
239KRRRRRK
3412RRRRRKNKK
4523RRRRKNKKGESNSAAKKRK
5723RRKNKKGESNSAAKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681120.16e-72PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotO232084e-55ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLA0A0J8C9L67e-72A0A0J8C9L6_BETVU; Uncharacterized protein
STRINGSolyc02g085630.2.13e-59(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.18e-53homeobox protein 40